PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_04071.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 381aa    MW: 42882.1 Da    PI: 6.7965
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_04071.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.59e-16187245260
                              XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                              ++ +r+rr++kNRe+A rsR+RK+a++ eLe+ +++Le+eN +L  e+e  +ke ++  
  Rsa1.0_04071.1_g00002.1 187 AAAQRQRRMIKNRESAARSRERKQAYQVELETLAAKLEQENVKLSLEIEDKRKERYQKL 245
                              5789********************************************99999888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.6E-13184241No hitNo description
SMARTSM003383.0E-12186250IPR004827Basic-leucine zipper domain
PfamPF001706.4E-15187247IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.806188240IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.13E-9190242No hitNo description
CDDcd147075.72E-17190230No hitNo description
PROSITE patternPS000360193208IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MASFKVMHSS SSSTNSDPSR RIPSSSSLRP QQLRRDPRIL GGYSPGTMTV EGILHETFAS  60
DPPATESSSL LMDAAAPTPM EGGGTETRVD EVWRGMKEEE ETAQREEMMT LEDFLAKATG  120
GGGEDGGESD DVDVKSYGFD HHNPFQMIDK VEGSIVAFGN GVDVYGGGGG GARGKRARVM  180
MEPLDKAAAQ RQRRMIKNRE SAARSRERKQ AYQVELETLA AKLEQENVKL SLEIEDKRKE  240
RYQKLMEFVI PVVDRPNHQP RFLRRIRSLE CTISVSVCCD DDDDDRYWKF ELGLLSQTIS  300
SAVRTWSFIY WDSTKTIWHK AGSGTCKHTH HFGKYTILWT PHLVKEGRLQ YHACILSRGS  360
TTWFQPSVIP TSWTWNGHLD N
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894021e-140AC189402.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB057L05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013706439.11e-143PREDICTED: G-box-binding factor 4-like isoform X1
RefseqXP_013706440.11e-143PREDICTED: G-box-binding factor 4-like isoform X2
SwissprotP427772e-53GBF4_ARATH; G-box-binding factor 4
TrEMBLA0A078GA921e-143A0A078GA92_BRANA; BnaA06g36330D protein
STRINGBra033719.1-P1e-141(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38522855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.16e-78bZIP family protein